PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005172-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 307aa    MW: 34015.4 Da    PI: 7.1502
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005172-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.6e-32111168260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    +DgynWrKYGqK+vkgsefprsYY+Ct+++C vkk+vers+ d +++ei+Y+g+H h+k
  NNU_005172-RA 111 EDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCLVKKQVERSH-DRQITEIIYKGSHYHPK 168
                    8****************************************.***************85 PP

2WRKY331.2e-10287307121
                    ---SS-EEEEEEE--TT-SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefp 21 
                    ldDgy+WrKYGqK+vkg+++p
  NNU_005172-RA 287 LDDGYRWRKYGQKVVKGNPNP 307
                    59*****************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.847105169IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.0E-28105169IPR003657WRKY domain
SuperFamilySSF1182904.45E-26107169IPR003657WRKY domain
SMARTSM007744.2E-35110168IPR003657WRKY domain
PfamPF031064.4E-25111167IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.8E-13272307IPR003657WRKY domain
SuperFamilySSF1182901.05E-8279307IPR003657WRKY domain
PROSITE profilePS5081115.571282307IPR003657WRKY domain
PfamPF031063.3E-6288307IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MCIQPNSDFS FKASAGLKYQ QREPLVQVQG QYQSHSFAAL SSAKSENSAV SSHELTLSVT  60
VPNPPGQLAT SGVQTASDEL QHKQGSDSGF QVFHNDHKGN NPPVVAEKTA EDGYNWRKYG  120
QKHVKGSEFP RSYYKCTHPN CLVKKQVERS HDRQITEIIY KGSHYHPKPQ SSRRSASGTI  180
LSIQGEKSDI FSSLTSSEDK SSNPRGQTTH HIEPNGTPEL SPVTVSDDDV EGAVGYSNRV  240
GDDFDDDEDP ESKRRKKDIG CVDVTPMAKP TREPRVVVQT LSEVDILDDG YRWRKYGQKV  300
VKGNPNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-161101691474WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252692.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
RefseqXP_010252693.10.0PREDICTED: probable WRKY transcription factor 20 isoform X3
SwissprotQ93WV04e-84WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLF6HER41e-109F6HER4_VITVI; Putative uncharacterized protein
STRINGVIT_19s0090g01720.t011e-108(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.16e-79WRKY family protein